Project name: SH3_W119Q

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA119Q
Energy difference between WT (input) and mutated protein (by FoldX)	2.75837 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.1907
• Average score: -0.917
• Total score value: -55.0217

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4508
82	S	A	-0.6824
83	H	A	-0.7912
84	M	A	0.2810
85	T	A	0.0000
86	F	A	-0.0410
87	V	A	-0.5913
88	A	A	0.0000
89	L	A	-0.3049
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3574
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9544
106	E	A	0.0000
107	R	A	-2.0532
108	L	A	0.0000
109	Q	A	-0.2322
110	I	A	0.3798
111	V	A	1.1907
112	N	A	-0.5132
113	N	A	-1.9320
114	T	A	-1.7913
115	E	A	-3.0120
116	G	A	-2.6751
117	D	A	-2.7601
118	W	A	-1.4978
119	Q	A	-1.0075	mutated: WA119Q
120	L	A	0.2532
121	A	A	0.0000
122	H	A	-0.4158
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4948
130	G	A	0.0000
131	Y	A	0.1145
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3877
135	N	A	-1.2894
136	Y	A	-0.2032
137	V	A	0.0000
138	A	A	-0.0033
139	P	A	-0.1223
140	S	A	-0.1529