Project name: SH3_L89G

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA89G
Energy difference between WT (input) and mutated protein (by FoldX)	1.92817 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4973
• Maximal score value: 1.2498
• Average score: -0.8938
• Total score value: -53.6263

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.0329
87	V	A	-0.5126
88	A	A	0.0000
89	G	A	-0.6257	mutated: LA89G
90	Y	A	-0.7253
91	D	A	-2.8549
92	Y	A	-2.1108
93	E	A	-2.8809
94	S	A	0.0000
95	R	A	-2.7835
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3227
100	L	A	0.0000
101	S	A	-1.9030
102	F	A	0.0000
103	K	A	-3.4973
104	K	A	-2.9051
105	G	A	-1.9871
106	E	A	0.0000
107	R	A	-1.9948
108	L	A	0.0000
109	Q	A	-0.2291
110	I	A	0.4569
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3419
119	W	A	-0.6978
120	L	A	0.4047
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2197
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2267
135	N	A	-1.2359
136	Y	A	-0.1916
137	V	A	-0.1216
138	A	A	0.0307
139	P	A	-0.0574
140	S	A	-0.1016