Project name: 12_w [mutate: NA267S]

Chain sequence(s)	A: KTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	NA267S
Energy difference between WT (input) and mutated protein (by FoldX)	-0.0407924 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.6235
• Maximal score value: 0.6676
• Average score: -1.0992
• Total score value: -184.6607

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
102	K	A	-2.6302
103	T	A	-1.7425
104	S	A	0.0000
105	D	A	0.0000
106	L	A	0.0000
107	I	A	0.0000
108	V	A	0.0000
109	L	A	0.0000
110	G	A	0.0000
111	L	A	0.0000
112	P	A	-0.6684
113	W	A	-0.3545
114	K	A	-1.7062
115	T	A	-1.6145
116	T	A	-1.4017
117	E	A	-1.8451
118	Q	A	-2.4106
119	D	A	-2.4715
120	L	A	0.0000
121	K	A	-2.3135
122	E	A	-2.6904
123	Y	A	-1.3023
124	F	A	0.0000
125	S	A	-1.1473
126	T	A	-0.5939
127	F	A	-0.4419
128	G	A	-1.2628
129	E	A	-1.8192
130	V	A	0.0000
131	L	A	0.6676
132	M	A	0.0000
133	V	A	0.0000
134	Q	A	-0.7140
135	V	A	-0.5635
136	K	A	-0.8466
137	K	A	-1.5347
138	D	A	-1.1531
139	L	A	-0.2053
140	K	A	-1.4277
141	T	A	-1.2174
142	G	A	-1.1520
143	H	A	-1.7323
144	S	A	-1.2460
145	K	A	-1.1047
146	G	A	0.0000
147	F	A	0.0000
148	G	A	0.0000
149	F	A	0.0000
150	V	A	0.0000
151	R	A	-0.2701
152	F	A	0.0000
153	T	A	-1.2041
154	E	A	-2.4693
155	Y	A	-1.7751
156	E	A	-2.1778
157	T	A	0.0000
158	Q	A	0.0000
159	V	A	-0.7316
160	K	A	-1.0239
161	V	A	0.0000
162	M	A	-0.8441
163	S	A	-1.2087
164	Q	A	-2.2125
165	R	A	-2.1150
166	H	A	0.0000
167	M	A	-0.1999
168	I	A	0.0000
169	D	A	-2.3297
170	G	A	-1.4114
171	R	A	-1.0485
172	W	A	0.0871
173	C	A	0.0000
174	D	A	-0.9024
175	C	A	0.0000
176	K	A	-1.2539
177	L	A	-0.5666
178	P	A	0.0000
179	N	A	-1.5628
180	S	A	-1.0955
181	K	A	0.0000
182	Q	A	-2.0195
183	S	A	-1.8968
184	Q	A	-2.9066
185	D	A	-3.5132
186	E	A	-2.8379
187	P	A	-1.4674
188	L	A	-0.4891
189	R	A	-2.6530
190	S	A	-3.0574
191	R	A	-2.8919
192	K	A	-2.1983
193	V	A	0.0000
194	F	A	-0.2168
195	V	A	0.0000
196	G	A	0.0000
197	R	A	-0.4165
198	C	A	0.0000
199	T	A	-1.4065
200	E	A	-2.5271
201	D	A	-3.0291
202	M	A	0.0000
203	T	A	-1.9051
204	E	A	-2.0250
205	D	A	-3.2482
206	E	A	-3.0355
207	L	A	0.0000
208	R	A	-3.0567
209	E	A	-3.2680
210	F	A	-1.8761
211	F	A	0.0000
212	S	A	-1.6230
213	Q	A	-1.6852
214	Y	A	-0.4521
215	G	A	-1.2935
216	D	A	-1.9551
217	V	A	0.0000
218	M	A	-0.7398
219	D	A	-1.8460
220	V	A	-1.1802
221	F	A	-0.0404
222	I	A	0.0000
223	P	A	0.0000
224	K	A	-1.7006
225	P	A	-1.3880
226	F	A	-0.9152
227	R	A	-0.8767
228	A	A	0.0000
229	F	A	0.0000
230	A	A	0.0000
231	F	A	0.0000
232	V	A	0.0000
233	T	A	-1.2234
234	F	A	0.0000
235	A	A	-1.5708
236	D	A	-2.4951
237	D	A	-3.6235
238	Q	A	-2.9727
239	I	A	-1.9443
240	A	A	0.0000
241	Q	A	-2.4024
242	S	A	-1.4674
243	L	A	0.0000
244	C	A	0.0000
245	G	A	-1.9066
246	E	A	-2.1088
247	D	A	0.0000
248	L	A	0.0000
249	I	A	-0.1854
250	I	A	0.0000
251	K	A	-2.0210
252	G	A	-0.9185
253	I	A	0.0000
254	S	A	0.0000
255	V	A	0.0000
256	H	A	-0.5119
257	I	A	0.0000
258	S	A	-0.7119
259	N	A	-1.3644
260	A	A	0.0000
261	E	A	-2.6505
262	P	A	-2.4436
263	K	A	-2.5791
264	H	A	-2.3962
265	N	A	-2.7525
266	S	A	-2.2273
267	S	A	-2.2910	mutated: NA267S
268	R	A	-2.8814
269	Q	A	-2.4115