Project name: SH3_P139S

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	PA139S
Energy difference between WT (input) and mutated protein (by FoldX)	2.47479 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2381
• Average score: -0.8967
• Total score value: -53.7999

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4621
82	S	A	-0.6963
83	H	A	-0.8097
84	M	A	0.2327
85	T	A	0.0000
86	F	A	-0.1026
87	V	A	-0.6119
88	A	A	0.0000
89	L	A	-0.3117
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3229
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9629
106	E	A	0.0000
107	R	A	-2.0710
108	L	A	0.0000
109	Q	A	-0.2656
110	I	A	0.4106
111	V	A	1.2381
112	N	A	-0.4268
113	N	A	-1.8196
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.7033
120	L	A	0.3982
121	A	A	0.0000
122	H	A	-0.3901
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4975
130	G	A	0.0000
131	Y	A	0.2169
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2871
135	N	A	-1.2471
136	Y	A	-0.2031
137	V	A	0.0000
138	A	A	0.0045
139	S	A	-0.1178	mutated: PA139S
140	S	A	-0.1637