Project name: SH3_V87Q

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	VA87Q
Energy difference between WT (input) and mutated protein (by FoldX)	0.0912603 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.6132
• Maximal score value: 1.2624
• Average score: -0.9706
• Total score value: -58.2377

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4461
82	S	A	-0.6760
83	H	A	-0.7865
84	M	A	0.2803
85	T	A	0.0000
86	F	A	-0.6654
87	Q	A	-1.7942	mutated: VA87Q
88	A	A	0.0000
89	L	A	-0.6374
90	Y	A	-0.8890
91	D	A	-2.8563
92	Y	A	-2.1075
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3229
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.6132
104	K	A	-3.0920
105	G	A	-2.3270
106	E	A	0.0000
107	R	A	-2.4866
108	L	A	0.0000
109	Q	A	-0.3591
110	I	A	0.4615
111	V	A	1.2624
112	N	A	-0.4144
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6973
120	L	A	0.4116
121	A	A	0.0000
122	H	A	-0.3659
123	S	A	0.0000
124	L	A	-0.2742
125	T	A	-0.7820
126	T	A	-0.8787
127	G	A	-0.8174
128	Q	A	-1.4114
129	T	A	-0.4887
130	G	A	0.0000
131	Y	A	0.2204
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2859
135	N	A	-1.2513
136	Y	A	-0.3837
137	V	A	0.0000
138	A	A	-0.3809
139	P	A	-0.4356
140	S	A	-0.5121