Project name: SH3_Y90F

Status: done

submitted: 2019-03-14 15:12:19, status changed: 2019-03-14 15:47:47
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues YA90F
Energy difference between WT (input) and mutated protein (by FoldX) -0.0891807 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.399
Maximal score value
1.2498
Average score
-0.8749
Total score value
-52.4931

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1015
87 V A -0.5769
88 A A 0.0000
89 L A -0.1323
90 F A -0.4064 mutated: YA90F
91 D A -2.6920
92 Y A -2.0245
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2414
99 D A -1.3229
100 L A 0.0000
101 S A -1.9034
102 F A 0.0000
103 K A -3.3990
104 K A -2.7184
105 G A -1.8975
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2491
110 I A 0.4370
111 V A 1.2498
112 N A -0.4200
113 N A -1.8144
114 T A -1.7328
115 E A -2.9364
116 G A -2.6088
117 D A -2.6849
118 W A -1.3432
119 W A -0.6982
120 L A 0.4045
121 A A 0.0000
122 H A -0.3840
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.4950
130 G A 0.0000
131 Y A 0.2195
132 I A 0.0000
133 P A 0.0000
134 S A -1.2881
135 N A -1.2108
136 Y A -0.1112
137 V A 0.0000
138 A A -0.0165
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015