Project name: SH3_Y90G

Status: done

submitted: 2019-03-14 15:12:21, status changed: 2019-03-14 15:48:16
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues YA90G
Energy difference between WT (input) and mutated protein (by FoldX) 1.60798 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.7327
Maximal score value
1.2498
Average score
-0.9373
Total score value
-56.2364

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.0322
87 V A -0.6297
88 A A 0.0000
89 L A -0.4833
90 G A -1.7458 mutated: YA90G
91 D A -3.3600
92 Y A -2.3516
93 E A -2.8840
94 S A 0.0000
95 R A -2.7842
96 T A -2.1540
97 E A -2.3526
98 T A -1.2414
99 D A -1.3234
100 L A 0.0000
101 S A -1.9051
102 F A 0.0000
103 K A -3.7327
104 K A -3.2220
105 G A -2.0816
106 E A 0.0000
107 R A -2.0624
108 L A 0.0000
109 Q A -0.2458
110 I A 0.4372
111 V A 1.2498
112 N A -0.4200
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3299
119 W A -0.6978
120 L A 0.4047
121 A A 0.0000
122 H A -0.3840
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.4950
130 G A 0.0000
131 Y A 0.2197
132 I A 0.0000
133 P A 0.0000
134 S A -1.2459
135 N A -1.2717
136 Y A -0.2933
137 V A 0.0000
138 A A 0.0936
139 P A -0.1430
140 S A -0.1681

 

Laboratory of Theory of Biopolymers 2015