Project name: TBP-6CMN [mutate: IA93K, AA95K] [mutate: KA93A]

Status: done

submitted: 2019-11-04 20:03:19, status changed: 2019-11-08 08:12:53
Settings
Chain sequence(s) A: ETRPNHTIYINNLNSKIKKDELKKSLHAIFSRFGQILDILVPRQRTPRGQAFVIFKEVSSATNALRSMQGFPFYDKPMAIQYAKTDKRKPK
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues KA93A
Energy difference between WT (input) and mutated protein (by FoldX) 0.798976 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.1418
Maximal score value
0.1071
Average score
-1.202
Total score value
-109.3803

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
5 E A -2.6246
6 T A -2.7000
7 R A -2.8686
8 P A -1.4557
9 N A -1.7399
10 H A -1.6885
11 T A 0.0000
12 I A 0.0000
13 Y A 0.0000
14 I A 0.0000
15 N A -0.8767
16 N A -1.1325
17 L A 0.0000
18 N A -1.6011
19 S A -1.5701
20 K A -2.1262
21 I A -1.9112
22 K A -2.9991
23 K A -2.7699
24 D A -3.1038
25 E A -3.1418
26 L A 0.0000
27 K A -2.6768
28 K A -2.9214
29 S A -1.6472
30 L A 0.0000
31 H A -1.9042
32 A A -1.0764
33 I A -0.6518
34 F A 0.0000
35 S A -1.2424
36 R A -2.0013
37 F A -1.1693
38 G A -1.6926
39 Q A -2.2966
40 I A -1.4930
41 L A -1.1328
42 D A -1.6816
43 I A 0.0000
44 L A -0.2398
45 V A -0.2218
46 P A -0.4305
47 R A -1.0746
48 Q A -0.9518
49 R A -0.8256
50 T A -0.6256
51 P A -0.9544
52 R A -0.9579
53 G A -0.8660
54 Q A 0.0000
55 A A 0.0000
56 F A -0.3090
57 V A 0.0000
58 I A 0.0000
59 F A 0.0000
60 K A -2.9774
61 E A -2.6378
62 V A -1.1699
63 S A -0.9494
64 S A 0.0000
65 A A 0.0000
66 T A -1.1955
67 N A -1.2876
68 A A 0.0000
69 L A -1.3839
70 R A -2.2766
71 S A -1.2003
72 M A 0.0000
73 Q A -1.3403
74 G A -0.6201
75 F A 0.1071
76 P A -0.6594
77 F A 0.0000
78 Y A -0.8258
79 D A -1.9287
80 K A -1.6659
81 P A -1.0042
82 M A 0.0000
83 A A -0.7173
84 I A 0.0000
85 Q A -1.8336
86 Y A -1.6026
87 A A 0.0000
88 K A -2.9343
89 T A -2.0400
90 D A -2.0947
91 K A -2.2990
92 R A -2.5144
93 A A -1.5266 mutated: KA93A
94 P A -1.5029
95 K A -1.9451

 

Laboratory of Theory of Biopolymers 2015