Project name: 1e9f98b374a6cfe

Status: done

submitted: 2019-01-18 16:48:34, status changed: 2019-01-22 16:09:17
Settings
Chain sequence(s) A: AEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPP
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.6047
Maximal score value
1.9879
Average score
-1.0235
Total score value
-84.9486

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
3 A A -0.9596
4 E A -2.3185
5 G A 0.0000
6 Y A 0.0000
7 Q A 0.0000
8 Y A 0.0000
9 R A -0.9993
10 A A 0.0000
11 L A 0.6906
12 Y A 1.1066
13 D A -1.1711
14 Y A -1.6249
15 K A -3.3152
16 K A -4.1077
17 E A -4.2742
18 R A -4.6047
19 E A -4.2185
20 E A -4.0947
21 D A 0.0000
22 I A 0.0000
23 D A -2.5052
24 L A 0.0000
25 H A -0.5219
26 L A 1.1897
27 G A 0.2912
28 D A 0.0000
29 I A -0.4676
30 L A 0.0000
31 T A -1.1950
32 V A 0.0000
33 N A -1.7544
34 K A -1.7465
35 G A -0.5590
36 S A -0.1147
37 L A 0.0000
38 V A 1.6257
39 A A 1.2940
40 L A 1.9879
41 G A 0.8087
42 F A 0.4006
43 S A -0.5809
44 D A -2.1466
45 G A -1.7351
46 Q A -2.2631
47 E A -2.0831
48 A A -1.9743
49 R A -3.4170
50 P A 0.0000
51 E A -3.0997
52 E A -3.1337
53 I A -1.4464
54 G A -0.9935
55 W A -0.0759
56 L A 0.0000
57 N A -1.0185
58 G A 0.0000
59 Y A -1.1293
60 N A 0.0000
61 E A -2.1400
62 T A -1.1481
63 T A -1.5058
64 G A -2.0352
65 E A -3.0306
66 R A -3.0690
67 G A 0.0000
68 D A -2.1106
69 F A 0.0000
70 P A 0.0000
71 G A 0.0000
72 T A -1.0323
73 Y A 0.0212
74 V A 0.0000
75 E A -2.0331
76 Y A -0.9760
77 I A 0.4905
78 G A -0.7334
79 R A -2.6085
80 K A -2.7352
81 K A -2.3905
82 I A -0.6779
83 S A -0.4592
84 P A -0.2225
85 P A -0.2976

 

Laboratory of Theory of Biopolymers 2015