Project name: SH3_Q109V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	QA109V
Energy difference between WT (input) and mutated protein (by FoldX)	-0.340922 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.5445
• Average score: -0.8133
• Total score value: -48.7966

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.3276
82	S	A	-0.5141
83	H	A	-0.6774
84	M	A	0.4565
85	T	A	0.0000
86	F	A	0.1831
87	V	A	-0.4627
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1546
97	E	A	-2.3532
98	T	A	-1.2427
99	D	A	-1.3251
100	L	A	0.0000
101	S	A	-1.9041
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-1.7636
108	L	A	0.0000
109	V	A	0.9512	mutated: QA109V
110	I	A	0.9525
111	V	A	1.5445
112	N	A	-0.2866
113	N	A	-1.8229
114	T	A	-1.7294
115	E	A	-2.9343
116	G	A	-2.6073
117	D	A	-2.6850
118	W	A	-1.3424
119	W	A	-0.7154
120	L	A	0.5494
121	A	A	0.0000
122	H	A	0.0287
123	S	A	0.0000
124	L	A	0.1685
125	T	A	-0.6873
126	T	A	-0.8234
127	G	A	-0.7598
128	Q	A	-1.3885
129	T	A	-0.3560
130	G	A	0.0000
131	Y	A	0.2018
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2930
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.0377
140	S	A	-0.1849