Project name: SH3_Y131L

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA131L
Energy difference between WT (input) and mutated protein (by FoldX)	0.151198 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4768
• Maximal score value: 1.0191
• Average score: -0.9225
• Total score value: -55.3498

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1047
87	V	A	-0.6192
88	A	A	0.0000
89	L	A	-0.2996
90	Y	A	-0.7088
91	D	A	-2.8397
92	Y	A	-2.0977
93	E	A	-2.8789
94	S	A	0.0000
95	R	A	-2.7797
96	T	A	-2.1464
97	E	A	-2.3454
98	T	A	-1.2163
99	D	A	-1.2857
100	L	A	0.0000
101	S	A	-1.8975
102	F	A	0.0000
103	K	A	-3.4768
104	K	A	-2.8500
105	G	A	-1.9568
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.3005
110	I	A	0.3113
111	V	A	1.0191
112	N	A	-0.9274
113	N	A	-2.0592
114	T	A	-1.8844
115	E	A	-3.0256
116	G	A	-2.6706
117	D	A	-2.6972
118	W	A	-1.4161
119	W	A	-0.8249
120	L	A	0.2991
121	A	A	0.0000
122	H	A	-0.4211
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4096
129	T	A	-0.4703
130	G	A	0.0000
131	L	A	0.1991	mutated: YA131L
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2829
135	N	A	-1.2507
136	Y	A	-0.2022
137	V	A	0.0000
138	A	A	-0.0219
139	P	A	-0.1505
140	S	A	-0.1759