Project name: SH3_R107P

Status: done

submitted: 2019-03-14 15:23:32, status changed: 2019-03-14 16:58:25
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues RA107P
Energy difference between WT (input) and mutated protein (by FoldX) 2.67518 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.2835
Maximal score value
1.2212
Average score
-0.7861
Total score value
-47.1639

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4628
82 S A -0.6987
83 H A -0.8045
84 M A 0.2410
85 T A 0.1510
86 F A 0.3650
87 V A 0.0008
88 A A 0.0000
89 L A -0.3068
90 Y A -0.7316
91 D A -2.8485
92 Y A -2.1063
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2408
99 D A -1.3222
100 L A 0.0000
101 S A -1.9032
102 F A 0.0000
103 K A -3.2835
104 K A -2.6211
105 G A -1.4978
106 E A 0.0000
107 P A -0.3186 mutated: RA107P
108 L A 0.0000
109 Q A 0.0504
110 I A 0.5594
111 V A 1.2212
112 N A -0.4325
113 N A -1.8138
114 T A -1.7326
115 E A -2.9361
116 G A -2.6085
117 D A -2.6844
118 W A -1.3421
119 W A -0.7000
120 L A 0.3890
121 A A 0.0000
122 H A -0.1504
123 S A 0.0000
124 L A 0.3858
125 T A -0.1694
126 T A -0.5897
127 G A -0.7516
128 Q A -1.3805
129 T A -0.4909
130 G A 0.0000
131 Y A 0.2169
132 I A 0.0000
133 P A 0.0000
134 S A -1.2855
135 N A -1.2494
136 Y A -0.2048
137 V A 0.0000
138 A A -0.0226
139 P A 0.0272
140 S A 0.0914

 

Laboratory of Theory of Biopolymers 2015