Project name: SH3_T114C

Status: done

submitted: 2019-03-14 15:27:34, status changed: 2019-03-14 17:22:51
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues TA114C
Energy difference between WT (input) and mutated protein (by FoldX) 0.271101 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.4128
Average score
-0.8457
Total score value
-50.7429

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1605
97 E A -2.3591
98 T A -1.2553
99 D A -1.3463
100 L A 0.0000
101 S A -1.9115
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2296
110 I A 0.4756
111 V A 1.4128
112 N A -0.0366
113 N A -1.3523
114 C A -0.8846 mutated: TA114C
115 E A -2.5200
116 G A -2.4039
117 D A -2.5946
118 W A -1.2248
119 W A -0.5122
120 L A 0.5480
121 A A 0.0000
122 H A -0.3738
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.5047
130 G A 0.0000
131 Y A 0.1856
132 I A 0.0000
133 P A 0.0000
134 S A -1.2921
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015