Project name: SH3_L120M

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120M
Energy difference between WT (input) and mutated protein (by FoldX)	0.264183 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2532
• Average score: -0.903
• Total score value: -54.182

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1627
97	E	A	-2.3613
98	T	A	-1.2807
99	D	A	-1.3797
100	L	A	0.0000
101	S	A	-1.9145
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0701
108	L	A	0.0000
109	Q	A	-0.2540
110	I	A	0.4239
111	V	A	1.2532
112	N	A	-0.3596
113	N	A	-1.7962
114	T	A	-1.7140
115	E	A	-2.9322
116	G	A	-2.5959
117	D	A	-2.6928
118	W	A	-1.3802
119	W	A	-0.7574
120	M	A	0.2710	mutated: LA120M
121	A	A	0.0000
122	H	A	-0.4119
123	S	A	0.0000
124	L	A	-0.2732
125	T	A	-0.7763
126	T	A	-0.8737
127	G	A	-0.8093
128	Q	A	-1.4089
129	T	A	-0.5396
130	G	A	0.0000
131	Y	A	0.0925
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3135
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759