Project name: SH3_H122W

Status: done

submitted: 2019-03-14 15:33:28, status changed: 2019-03-14 17:57:03
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues HA122W
Energy difference between WT (input) and mutated protein (by FoldX) -0.557298 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.4752
Average score
-0.8451
Total score value
-50.7064

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4279
82 S A -0.6517
83 H A -0.7691
84 M A 0.3066
85 T A 0.0000
86 F A -0.0535
87 V A -0.5960
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2415
99 D A -1.3230
100 L A 0.0000
101 S A -1.9037
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0059
108 L A 0.0000
109 Q A 0.1497
110 I A 0.7170
111 V A 1.4752
112 N A -0.3156
113 N A -1.8138
114 T A -1.7326
115 E A -2.9361
116 G A -2.6085
117 D A -2.6844
118 W A -1.3421
119 W A -0.6198
120 L A 0.5905
121 A A 0.0000
122 W A 0.3575 mutated: HA122W
123 S A 0.0000
124 L A -0.2997
125 T A -0.7998
126 T A -0.8326
127 G A -0.6962
128 Q A -1.2357
129 T A -0.1869
130 G A 0.0000
131 Y A 0.3244
132 I A 0.0000
133 P A 0.0000
134 S A -1.2855
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1294
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015