Project name: SH3_G127Y

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	GA127Y
Energy difference between WT (input) and mutated protein (by FoldX)	3.47254 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4828
• Maximal score value: 1.257
• Average score: -0.8221
• Total score value: -49.327

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3229
100	L	A	0.0000
101	S	A	-1.9025
102	F	A	0.0000
103	K	A	-3.4828
104	K	A	-2.8616
105	G	A	-1.9620
106	E	A	0.0000
107	R	A	-2.1705
108	L	A	0.0000
109	Q	A	-0.3108
110	I	A	0.4449
111	V	A	1.2570
112	N	A	-0.4166
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6946
120	L	A	0.4113
121	A	A	0.0000
122	H	A	-0.0396
123	S	A	0.0000
124	L	A	-0.0229
125	T	A	-0.4573
126	T	A	-0.1135
127	Y	A	0.8287	mutated: GA127Y
128	Q	A	-0.6077
129	T	A	-0.1180
130	G	A	0.0000
131	Y	A	0.2241
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759