Project name: SH3_Q109I

Status: done

submitted: 2019-03-14 15:24:05, status changed: 2019-03-14 16:59:38
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues QA109I
Energy difference between WT (input) and mutated protein (by FoldX) -0.939488 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.6427
Average score
-0.8007
Total score value
-48.0416

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.2755
82 S A -0.4441
83 H A -0.6152
84 M A 0.5732
85 T A 0.0000
86 F A 0.2870
87 V A -0.4139
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2408
99 D A -1.3223
100 L A 0.0000
101 S A -1.9031
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -1.7700
108 L A 0.0000
109 I A 1.2711 mutated: QA109I
110 I A 1.1392
111 V A 1.6427
112 N A -0.2518
113 N A -1.8276
114 T A -1.7326
115 E A -2.9361
116 G A -2.6085
117 D A -2.6844
118 W A -1.3421
119 W A -0.7158
120 L A 0.6024
121 A A 0.0000
122 H A 0.0947
123 S A 0.0000
124 L A -0.0275
125 T A -0.8201
126 T A -0.9007
127 G A -0.8389
128 Q A -1.4306
129 T A -0.3393
130 G A 0.0000
131 Y A 0.2073
132 I A 0.0000
133 P A 0.0000
134 S A -1.2921
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A 0.0101
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015