Project name: 2ejy chain A

Status: done

submitted: 2018-10-22 10:38:39, status changed: 2018-10-22 10:43:37
Settings
Chain sequence(s) A: VRLIQFEKVTEEPMGICLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIPNQQ
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.4408
Maximal score value
1.317
Average score
-1.3668
Total score value
-116.18

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
69 V A 1.3170
70 R A -0.2213
71 L A 0.7126
72 I A 0.1867
73 Q A -1.2527
74 F A 0.0000
75 E A -1.6387
76 K A 0.0000
77 V A 0.0400
78 T A -1.4878
79 E A -3.3235
80 E A -2.9484
81 P A -1.6340
82 M A -0.8689
83 G A 0.0000
84 I A 0.1341
85 C A -0.1601
86 L A -0.9232
87 K A -2.3399
88 L A -2.7250
89 N A -3.5465
90 E A -3.8896
91 K A -3.5619
92 Q A -3.4542
93 S A -2.2102
94 C A 0.0000
95 T A -1.1226
96 V A 0.0000
97 A A -1.0021
98 R A -1.5215
99 I A -0.2734
100 L A -0.1080
101 H A -1.1897
102 G A -1.0790
103 G A -1.1168
104 M A -1.2599
105 I A 0.0000
106 H A -1.8813
107 R A -2.8937
108 Q A -2.4168
109 G A -1.8388
110 S A -1.0537
111 L A -0.3464
112 H A -1.1227
113 V A -0.7097
114 G A -1.1663
115 D A -1.2889
116 E A -0.7033
117 I A 0.0000
118 L A -0.2979
119 E A -1.1562
120 I A 0.0000
121 N A -1.3594
122 G A -1.2181
123 T A -1.1541
124 N A -1.2025
125 V A 0.0000
126 T A -2.2508
127 N A -3.0596
128 H A -1.9994
129 S A -1.6069
130 V A -1.9485
131 D A -3.0085
132 Q A -2.8110
133 L A 0.0000
134 Q A -3.4077
135 K A -4.0167
136 A A -3.0702
137 M A 0.0000
138 K A -4.4408
139 E A -3.9858
140 T A -2.7675
141 K A -2.3430
142 G A -0.8944
143 M A -0.6274
144 I A 0.0000
145 S A -0.8386
146 L A 0.0000
147 K A -0.4853
148 V A 0.0000
149 I A -0.0308
150 P A -1.3343
151 N A -2.3201
152 Q A -2.4637
153 Q A -2.1907

 

Laboratory of Theory of Biopolymers 2015