Project name: SH3_Y131T

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA131T
Energy difference between WT (input) and mutated protein (by FoldX)	0.851791 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4771
• Maximal score value: 0.9845
• Average score: -0.948
• Total score value: -56.8793

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1047
87	V	A	-0.6192
88	A	A	0.0000
89	L	A	-0.2997
90	Y	A	-0.7092
91	D	A	-2.8403
92	Y	A	-2.1005
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7823
96	T	A	-2.2079
97	E	A	-2.4072
98	T	A	-1.3489
99	D	A	-1.5004
100	L	A	0.0000
101	S	A	-1.9729
102	F	A	0.0000
103	K	A	-3.4771
104	K	A	-2.8502
105	G	A	-1.9568
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2889
110	I	A	0.2721
111	V	A	0.9845
112	N	A	-0.9572
113	N	A	-2.0805
114	T	A	-1.8626
115	E	A	-2.9932
116	G	A	-2.6479
117	D	A	-2.7134
118	W	A	-1.4640
119	W	A	-0.9242
120	L	A	0.1648
121	A	A	0.0000
122	H	A	-0.4787
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4110
129	T	A	-0.5620
130	G	A	0.0000
131	T	A	-0.2756	mutated: YA131T
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3167
135	N	A	-1.2394
136	Y	A	-0.1941
137	V	A	0.0000
138	A	A	-0.0219
139	P	A	-0.1505
140	S	A	-0.1759