Project name: 23ab097d5982e61

Chain sequence(s)	A: LVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVI
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -2.4313
• Maximal score value: 2.9822
• Average score: -0.1403
• Total score value: -4.7697

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	L	A	2.1894
2	V	A	2.3307
3	G	A	1.3185
4	W	A	1.0989
5	S	A	0.1547
6	R	A	-0.8185
7	Y	A	0.3622
8	I	A	0.0000
9	P	A	-1.0694
10	E	A	-1.7920
11	G	A	-0.6580
12	M	A	0.2487
13	Q	A	-0.8171
14	C	A	-0.3751
15	S	A	-0.0752
16	C	A	0.3240
17	G	A	-0.3920
18	I	A	0.0000
19	D	A	-1.5894
20	Y	A	-1.1029
21	Y	A	-0.9125
22	T	A	-0.7518
23	P	A	-1.2600
24	H	A	-1.8144
25	E	A	0.0000
26	E	A	-2.4313
27	T	A	-1.2124
28	N	A	-1.3792
29	N	A	-1.4697
30	E	A	-1.5153
31	S	A	0.5827
32	F	A	2.2057
33	V	A	2.8688
34	I	A	2.9822