Project name: SH3_S140E

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA140E
Energy difference between WT (input) and mutated protein (by FoldX)	-0.171324 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4956
• Maximal score value: 1.2508
• Average score: -0.9899
• Total score value: -59.3916

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4513
82	S	A	-0.6832
83	H	A	-0.7923
84	M	A	-0.0729
85	T	A	-0.7464
86	F	A	-0.7701
87	V	A	-1.2707
88	A	A	0.0000
89	L	A	-0.3664
90	Y	A	-0.7618
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3229
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4956
104	K	A	-2.8885
105	G	A	-2.0022
106	E	A	0.0000
107	R	A	-2.3055
108	L	A	0.0000
109	Q	A	-0.2548
110	I	A	0.4463
111	V	A	1.2508
112	N	A	-0.4196
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6978
120	L	A	0.4052
121	A	A	0.0000
122	H	A	-0.3689
123	S	A	0.0000
124	L	A	-0.2462
125	T	A	-0.7500
126	T	A	-0.8640
127	G	A	-0.8153
128	Q	A	-1.4110
129	T	A	-0.4939
130	G	A	0.0000
131	Y	A	0.2197
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2345
137	V	A	0.0000
138	A	A	-0.4855
139	P	A	-0.9828
140	E	A	-1.8318	mutated: SA140E