Project name: SH3_I110T

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	IA110T
Energy difference between WT (input) and mutated protein (by FoldX)	2.86097 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.0775
• Average score: -0.9276
• Total score value: -55.6577

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4950
82	S	A	-0.7222
83	H	A	-0.7912
84	M	A	0.1695
85	T	A	0.0000
86	F	A	0.0000
87	V	A	-0.7219
88	A	A	0.0000
89	L	A	-0.3370
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3223
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9867
106	E	A	0.0000
107	R	A	-2.1658
108	L	A	0.0000
109	Q	A	-0.4762
110	T	A	0.0398	mutated: IA110T
111	V	A	1.0775
112	N	A	-0.5172
113	N	A	-1.8910
114	T	A	-1.7310
115	E	A	-2.9346
116	G	A	-2.6071
117	D	A	-2.6832
118	W	A	-1.3396
119	W	A	-0.7740
120	L	A	0.3114
121	A	A	0.0000
122	H	A	-0.4726
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.5324
130	G	A	0.0000
131	Y	A	0.1800
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3226
135	N	A	-1.2477
136	Y	A	-0.2257
137	V	A	0.0000
138	A	A	-0.0882
139	P	A	-0.2774
140	S	A	-0.2496