Project name: SH3_T125Y

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	TA125Y
Energy difference between WT (input) and mutated protein (by FoldX)	-1.32831 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.2378
• Maximal score value: 1.2498
• Average score: -0.795
• Total score value: -47.6998

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	0.0326
87	V	A	-0.4219
88	A	A	0.0000
89	L	A	-0.2664
90	Y	A	-0.7036
91	D	A	-2.8271
92	Y	A	-2.1057
93	E	A	-2.8817
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1541
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3230
100	L	A	0.0000
101	S	A	-1.9049
102	F	A	0.0000
103	K	A	-3.2378
104	K	A	-2.7208
105	G	A	-1.5036
106	E	A	0.0000
107	R	A	-1.2351
108	L	A	0.0000
109	Q	A	-0.1771
110	I	A	0.4777
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6978
120	L	A	0.4047
121	A	A	0.0000
122	H	A	-0.1582
123	S	A	0.0000
124	L	A	0.4493
125	Y	A	0.7018	mutated: TA125Y
126	T	A	-0.1873
127	G	A	-0.4648
128	Q	A	-1.2074
129	T	A	-0.5044
130	G	A	0.0000
131	Y	A	0.2196
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1063
140	S	A	-0.1127