Project name: SH3_W118S

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA118S
Energy difference between WT (input) and mutated protein (by FoldX)	2.45691 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4587
• Maximal score value: 1.2538
• Average score: -0.9454
• Total score value: -56.7244

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1038
87	V	A	-0.6194
88	A	A	0.0000
89	L	A	-0.2931
90	Y	A	-0.6978
91	D	A	-2.8036
92	Y	A	-2.0421
93	E	A	-2.8647
94	S	A	0.0000
95	R	A	-2.8056
96	T	A	-2.1998
97	E	A	-2.3948
98	T	A	-1.3106
99	D	A	-1.5234
100	L	A	0.0000
101	S	A	-1.9110
102	F	A	0.0000
103	K	A	-3.4587
104	K	A	-2.8402
105	G	A	-1.9589
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2489
110	I	A	0.4410
111	V	A	1.2538
112	N	A	-0.4787
113	N	A	-1.9063
114	T	A	-1.7990
115	E	A	-3.0671
116	G	A	-2.7479
117	D	A	-2.9255
118	S	A	-1.8465	mutated: WA118S
119	W	A	-0.9494
120	L	A	0.2819
121	A	A	0.0000
122	H	A	-0.3795
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4282
129	T	A	-0.5169
130	G	A	0.0000
131	Y	A	0.0407
132	I	A	0.0000
133	P	A	-0.7663
134	S	A	-1.4542
135	N	A	-1.3246
136	Y	A	-0.2444
137	V	A	0.0000
138	A	A	-0.0203
139	P	A	-0.1505
140	S	A	-0.1759