Project name: retro9 [mutate: AA119T]

Chain sequence(s)	A: MEEPQSDLSTELPLSQETFSYLGKLLPEKLVLSPSLSPAAEAVDDLLLPEDAADWLESQAGAQGISEAPTLATSWTLSSSVPSQKTYPAPIVSVWASCILGQPSLSPTRTPLNLTCCFAGWQRPVQCSCGSPQHPRPAPVFTPWPSTRRQHMMEVVKHCPHLECRCDYSDCLDPPQHLIQ
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	AA119T
Energy difference between WT (input) and mutated protein (by FoldX)	0.803193 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -2.744
• Maximal score value: 3.0004
• Average score: -0.1724
• Total score value: -31.0231

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	-1.4639
2	E	A	-2.6410
3	E	A	-2.7440
4	P	A	-1.7110
5	Q	A	-1.9331
6	S	A	-1.6608
7	D	A	-1.6948
8	L	A	0.0242
9	S	A	0.0311
10	T	A	-0.3938
11	E	A	-1.8927
12	L	A	-0.5929
13	P	A	-0.2919
14	L	A	0.2839
15	S	A	-0.0303
16	Q	A	-0.0816
17	E	A	-0.2183
18	T	A	0.0963
19	F	A	0.6600
20	S	A	0.7241
21	Y	A	0.0000
22	L	A	1.4029
23	G	A	-0.2301
24	K	A	-1.5050
25	L	A	0.3825
26	L	A	0.0000
27	P	A	-1.7106
28	E	A	-2.0912
29	K	A	-1.0865
30	L	A	0.1903
31	V	A	0.5678
32	L	A	0.6974
33	S	A	0.4507
34	P	A	0.1588
35	S	A	-0.0775
36	L	A	0.0930
37	S	A	-0.4122
38	P	A	-0.0139
39	A	A	0.4150
40	A	A	0.5267
41	E	A	0.6894
42	A	A	0.6626
43	V	A	1.5009
44	D	A	-0.1705
45	D	A	0.0000
46	L	A	0.9678
47	L	A	1.6107
48	L	A	0.8768
49	P	A	0.0000
50	E	A	0.1666
51	D	A	-0.3746
52	A	A	0.0000
53	A	A	-0.5298
54	D	A	0.0508
55	W	A	0.0000
56	L	A	0.0245
57	E	A	-0.6716
58	S	A	-1.2627
59	Q	A	-1.3653
60	A	A	-0.5431
61	G	A	0.0476
62	A	A	-0.0200
63	Q	A	-0.1320
64	G	A	0.0000
65	I	A	0.7050
66	S	A	-0.1503
67	E	A	-1.5022
68	A	A	-0.5334
69	P	A	-0.0301
70	T	A	0.5256
71	L	A	1.5191
72	A	A	0.4290
73	T	A	-0.4999
74	S	A	-0.1525
75	W	A	-0.2464
76	T	A	0.0000
77	L	A	0.0720
78	S	A	-0.0648
79	S	A	0.0000
80	S	A	0.0000
81	V	A	0.0000
82	P	A	-0.6986
83	S	A	-0.8466
84	Q	A	-1.3809
85	K	A	-2.3206
86	T	A	-0.8081
87	Y	A	0.4895
88	P	A	0.9618
89	A	A	0.9885
90	P	A	1.0274
91	I	A	2.9135
92	V	A	3.0004
93	S	A	1.9318
94	V	A	2.0968
95	W	A	0.0000
96	A	A	0.9179
97	S	A	0.3002
98	C	A	1.2319
99	I	A	1.7909
100	L	A	0.0000
101	G	A	-0.3275
102	Q	A	-0.7755
103	P	A	-0.6621
104	S	A	-0.4031
105	L	A	0.0000
106	S	A	-0.3613
107	P	A	-0.0265
108	T	A	-0.6168
109	R	A	-0.9626
110	T	A	-0.0261
111	P	A	0.4667
112	L	A	1.4104
113	N	A	0.6178
114	L	A	1.3664
115	T	A	0.4439
116	C	A	0.9812
117	C	A	0.0000
118	F	A	1.7560
119	T	A	0.4149	mutated: AA119T
120	G	A	-0.6272
121	W	A	-1.1009
122	Q	A	-1.9502
123	R	A	-2.2211
124	P	A	-0.4648
125	V	A	1.0809
126	Q	A	0.5213
127	C	A	0.6217
128	S	A	0.1023
129	C	A	0.1700
130	G	A	-0.8462
131	S	A	-0.9228
132	P	A	-1.3462
133	Q	A	-2.3285
134	H	A	-2.3987
135	P	A	-1.8878
136	R	A	-1.3097
137	P	A	-0.6434
138	A	A	0.0000
139	P	A	-0.6433
140	V	A	0.0000
141	F	A	0.0000
142	T	A	0.0000
143	P	A	0.0000
144	W	A	0.0000
145	P	A	0.0000
146	S	A	0.0000
147	T	A	-1.0059
148	R	A	-1.9619
149	R	A	0.0000
150	Q	A	-1.6450
151	H	A	-0.8282
152	M	A	0.1951
153	M	A	0.0000
154	E	A	-0.2984
155	V	A	0.0000
156	V	A	0.0815
157	K	A	0.0000
158	H	A	-0.3128
159	C	A	0.0000
160	P	A	-0.6567
161	H	A	-0.7806
162	L	A	-0.7669
163	E	A	0.0000
164	C	A	0.0375
165	R	A	0.0000
166	C	A	-0.7010
167	D	A	-1.6105
168	Y	A	-0.3680
169	S	A	-0.7840
170	D	A	-1.4146
171	C	A	-0.0004
172	L	A	0.8784
173	D	A	0.1395
174	P	A	-0.4768
175	P	A	-1.0424
176	Q	A	-1.6864
177	H	A	-0.9713
178	L	A	0.9025
179	I	A	1.4679
180	Q	A	0.0625