Project name: SH3_L124F

Status: done

submitted: 2019-03-14 15:33:42, status changed: 2019-03-14 17:59:18
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues LA124F
Energy difference between WT (input) and mutated protein (by FoldX) 1.86284 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.2771
Average score
-0.8323
Total score value
-49.94

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4376
82 S A -0.6646
83 H A -0.7784
84 M A 0.2899
85 T A 0.0000
86 F A -0.0749
87 V A -0.6071
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2407
99 D A -1.3221
100 L A 0.0000
101 S A -1.9030
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -1.7321
108 L A 0.0000
109 Q A 0.0791
110 I A 0.4890
111 V A 1.2771
112 N A -0.4080
113 N A -1.8138
114 T A -1.7326
115 E A -2.9361
116 G A -2.6085
117 D A -2.6844
118 W A -1.3421
119 W A -0.6994
120 L A 0.4183
121 A A 0.0000
122 H A -0.0909
123 S A 0.0000
124 F A 0.7815 mutated: LA124F
125 T A -0.2714
126 T A -0.5585
127 G A -0.4555
128 Q A -1.2187
129 T A -0.3522
130 G A 0.0000
131 Y A 0.2178
132 I A 0.0000
133 P A 0.0000
134 S A -1.2855
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1383
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015