Project name: SH3_Y90P

Status: done

submitted: 2019-03-14 15:12:42, status changed: 2019-03-14 15:52:28
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues YA90P
Energy difference between WT (input) and mutated protein (by FoldX) 2.77436 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.754
Maximal score value
1.2498
Average score
-0.9521
Total score value
-57.1289

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.0663
87 V A -0.6902
88 A A 0.0000
89 L A -0.6921
90 P A -1.8274 mutated: YA90P
91 D A -3.3950
92 Y A -2.3775
93 E A -2.8834
94 S A 0.0000
95 R A -2.7841
96 T A -2.1540
97 E A -2.3526
98 T A -1.2414
99 D A -1.3233
100 L A 0.0000
101 S A -1.9046
102 F A 0.0000
103 K A -3.7540
104 K A -3.2890
105 G A -2.1245
106 E A 0.0000
107 R A -2.0624
108 L A 0.0000
109 Q A -0.2458
110 I A 0.4372
111 V A 1.2498
112 N A -0.4200
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3394
119 W A -0.6978
120 L A 0.4047
121 A A 0.0000
122 H A -0.3840
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.4950
130 G A 0.0000
131 Y A 0.2197
132 I A 0.0000
133 P A 0.0000
134 S A -1.2760
135 N A -1.3414
136 Y A -0.4397
137 V A 0.0000
138 A A 0.0326
139 P A -0.1430
140 S A -0.1681

 

Laboratory of Theory of Biopolymers 2015