Project name: teste

Status: done

submitted: 2018-12-18 18:07:53, status changed: 2018-12-18 20:30:07
Settings
Chain sequence(s) A: VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGY
Distance of aggregation 10 Å
Dynamic mode Yes
Show buried residues

Minimal score value
-3.4688
Maximal score value
1.151
Average score
-1.1863
Total score value
-179.1344

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.1510
2 L A -0.2074
3 S A -0.9621
4 E A -2.2881
5 G A -1.6638
6 E A -1.6134
7 W A -1.3947
8 Q A -1.7385
9 L A -1.0647
10 V A 0.0000
11 L A -0.5528
12 H A -1.0317
13 V A 0.0000
14 W A 0.0000
15 A A -1.1029
16 K A -1.3439
17 V A 0.0000
18 E A -1.9907
19 A A -1.3520
20 D A -1.5131
21 V A -1.2044
22 A A -1.1183
23 G A -1.0627
24 H A -1.1431
25 G A 0.0000
26 Q A -1.4206
27 D A -1.3418
28 I A 0.0000
29 L A 0.0000
30 I A -0.9565
31 R A -1.5935
32 L A 0.0000
33 F A -1.5460
34 K A -2.1231
35 S A -1.6036
36 H A -2.0391
37 P A -2.2087
38 E A -2.2152
39 T A 0.0000
40 L A -2.1557
41 E A -3.3273
42 K A -2.4227
43 F A 0.0000
44 D A -3.0248
45 R A -2.7698
46 F A 0.0000
47 K A -3.4688
48 H A -2.9134
49 L A -2.0894
50 K A -2.4774
51 T A -1.6306
52 E A -1.4472
53 A A -1.0630
54 E A -1.8054
55 M A 0.0000
56 K A -1.7759
57 A A -1.6518
58 S A -2.2831
59 E A -3.4369
60 D A -2.9613
61 L A 0.0000
62 K A -3.3076
63 K A -3.1052
64 H A -1.6998
65 G A 0.0000
66 V A -0.5451
67 T A -0.5609
68 V A 0.0000
69 L A 0.0000
70 T A -0.2041
71 A A 0.1479
72 L A 0.0000
73 G A 0.0000
74 A A -0.3838
75 I A 0.0000
76 L A 0.0000
77 K A -1.4344
78 K A 0.0000
79 K A -2.4361
80 G A -1.1537
81 H A -1.4998
82 H A -2.3050
83 E A -2.8798
84 A A -1.8021
85 E A -2.3535
86 L A 0.0000
87 K A -1.9724
88 P A -1.3931
89 L A -0.9461
90 A A 0.0000
91 Q A -1.6660
92 S A -1.4337
93 H A 0.0000
94 A A -1.4796
95 T A -1.4955
96 K A -2.5703
97 H A -2.2431
98 K A -1.7230
99 I A 0.0000
100 P A 0.0000
101 I A 0.0000
102 K A -1.8920
103 Y A 0.0000
104 L A 0.0000
105 E A -1.4299
106 F A -0.8006
107 I A 0.0000
108 S A 0.0000
109 E A -1.7779
110 A A -1.2456
111 I A 0.0000
112 I A -1.1932
113 H A -1.7646
114 V A 0.0000
115 L A 0.0000
116 H A -1.7804
117 S A -1.3543
118 R A -1.8820
119 H A -2.3694
120 P A -2.2401
121 G A -2.1150
122 D A -2.4866
123 F A 0.0000
124 G A -1.8853
125 A A -1.9335
126 D A -2.1844
127 A A 0.0000
128 Q A 0.0000
129 G A -1.6029
130 A A 0.0000
131 M A 0.0000
132 N A -1.7264
133 K A -1.6163
134 A A 0.0000
135 L A 0.0000
136 E A -1.3371
137 L A -0.4334
138 F A 0.0000
139 R A -1.5403
140 K A -2.1655
141 D A -1.3676
142 I A 0.0000
143 A A -1.7490
144 A A -1.5435
145 K A -1.5640
146 Y A -1.5486
147 K A -2.0467
148 E A -1.8188
149 L A -0.6751
150 G A -0.8210
151 Y A 0.1523

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -1.1863 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015