Project name: 3J9T chain H

Status: done

submitted: 2018-11-15 15:14:51, status changed: 2018-11-15 15:23:05
Settings
Chain sequence(s) H: SQKNGIATLLQAEKEAHEIVSKARKYRQDKLKQAKTDAAKEIDSYKIQKDKELKEFEQKNAGGVGELEKKAEAGVQGELAEIKKIAEKKKDDVVKILIETVIKPS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.6568
Maximal score value
3.3164
Average score
-1.9622
Total score value
-206.0309

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
2 S H -1.6771
3 Q H -2.3901
4 K H -2.6741
5 N H -2.2732
6 G H -1.0521
7 I H -0.0025
8 A H -0.3790
9 T H -0.1437
10 L H 0.3170
11 L H 0.1075
12 Q H -1.3870
13 A H -1.7274
14 E H -2.7641
15 K H -3.5820
16 E H -3.2480
17 A H -1.9049
18 H H -2.3348
19 E H -2.5791
20 I H 0.0833
21 V H 0.1672
22 S H -1.3823
23 K H -1.6624
24 A H -1.6242
25 R H -3.6295
26 K H -3.6439
27 Y H -2.5571
28 R H -4.3411
29 Q H -4.4146
30 D H -4.5345
31 K H -4.2295
32 L H -2.3450
33 K H -4.1553
34 Q H -4.1439
35 A H -2.7603
36 K H -3.3175
37 T H -3.1345
38 D H -3.4297
39 A H -2.2288
40 A H -2.1218
41 K H -2.8314
42 E H -1.7974
43 I H -0.0272
44 D H -1.5677
45 S H -0.9199
46 Y H -0.4379
47 K H -1.6513
48 I H -0.5527
49 Q H -2.2359
50 K H -3.2294
51 D H -2.7083
52 K H -3.7783
53 E H -3.8199
54 L H -2.5610
55 K H -4.0716
56 E H -3.9328
57 F H -1.8522
58 E H -3.3988
59 Q H -3.4137
60 K H -3.2886
61 N H -2.5825
62 A H -1.4685
63 G H -1.7527
64 G H -1.5614
65 V H 0.1441
66 G H -1.2335
67 E H -2.7112
68 L H -1.1860
69 E H -3.3394
70 K H -4.1378
71 K H -3.7411
72 A H -2.9334
73 E H -3.7384
74 A H -2.6841
75 G H -2.1189
76 V H -1.2468
77 Q H -2.0394
78 G H -2.0280
79 E H -2.5374
80 L H -1.1801
81 A H -1.8447
82 E H -2.8380
83 I H -1.0154
84 K H -2.8162
85 K H -3.5024
86 I H -1.9871
87 A H -2.8354
88 E H -4.5143
89 K H -4.6568
90 K H -4.2075
91 K H -4.0726
92 D H -3.0638
93 D H -2.4192
94 V H 0.5324
95 V H 0.5543
96 K H -0.0217
97 I H 2.4481
98 L H 3.3164
99 I H 2.9759
100 E H 0.6333
101 T H 1.2923
102 V H 2.7069
103 I H 1.9686
104 K H -0.6108
105 P H -0.5728
106 S H -0.2279

 

Laboratory of Theory of Biopolymers 2015