Project name: 3036adc16e3e043

Chain sequence(s)	A: MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -3.7678
• Maximal score value: 1.2099
• Average score: -1.4072
• Total score value: -78.8005

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.6624
2	T	A	-0.5603
3	Y	A	0.0000
4	K	A	-1.8362
5	L	A	0.0000
6	I	A	-1.0681
7	L	A	0.0000
8	N	A	-1.8856
9	G	A	0.0000
10	K	A	-2.4062
11	T	A	-1.2069
12	L	A	-1.2113
13	K	A	-2.3234
14	G	A	-1.6799
15	E	A	-2.3560
16	T	A	-1.0820
17	T	A	-1.2234
18	T	A	0.0000
19	E	A	-1.3581
20	A	A	0.0000
21	V	A	1.2099
22	D	A	-0.2705
23	A	A	-0.7805
24	A	A	-0.7994
25	T	A	-1.1374
26	A	A	0.0000
27	E	A	-2.5770
28	K	A	-2.7144
29	V	A	-1.6197
30	F	A	0.0000
31	K	A	-3.0028
32	Q	A	-2.7336
33	Y	A	-1.4781
34	A	A	0.0000
35	N	A	-3.4338
36	D	A	-3.2170
37	N	A	-3.1308
38	G	A	-2.7888
39	V	A	0.0000
40	D	A	-3.7678
41	G	A	-3.0059
42	E	A	-2.8545
43	W	A	-1.6056
44	T	A	-0.6675
45	Y	A	-0.9619
46	D	A	-1.9841
47	D	A	-2.5093
48	A	A	-1.4117
49	T	A	-1.4750
50	K	A	-2.1122
51	T	A	-1.7420
52	F	A	0.0000
53	T	A	-0.7510
54	V	A	0.0000
55	T	A	-2.4211
56	E	A	-3.5220