Project name: p53 dyn

Status: done

submitted: 2019-01-18 13:53:20, status changed: 2019-01-22 18:33:56
Settings
Chain sequence(s) A: SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHH
Distance of aggregation 10 Å
Dynamic mode Yes
Show buried residues

Minimal score value
-4.1677
Maximal score value
2.1801
Average score
-0.7441
Total score value
-151.7992

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
94 S A -0.1692
95 S A 0.3902
96 S A 0.8248
97 V A 2.1801
98 P A 0.0000
99 S A -0.0255
100 Q A 0.0000
101 K A -1.1483
102 T A -0.7381
103 Y A -0.1053
104 Q A -0.9148
105 G A -0.7312
106 S A -0.1962
107 Y A 0.2563
108 G A -0.4247
109 F A 0.0000
110 R A -1.1386
111 L A 0.0000
112 G A 0.0000
113 F A 0.0000
114 L A 2.0756
115 H A 0.7848
116 S A 0.1384
117 G A -0.7283
118 T A -0.5730
119 A A -0.8880
120 K A -2.0107
121 S A -0.9398
122 V A 0.0860
123 T A 0.2526
124 C A 0.0000
125 T A 0.0000
126 Y A 0.0000
127 S A 0.0000
128 P A 0.0834
129 A A 0.1319
130 L A 1.3541
131 N A 0.2023
132 K A -0.2734
133 M A 0.0000
134 F A 0.0000
135 C A 0.0000
136 Q A 0.4164
137 L A 0.7862
138 A A 0.1043
139 K A 0.0000
140 T A -0.2746
141 C A 0.0000
142 P A -0.0828
143 V A 0.0000
144 Q A -0.2371
145 L A 0.0000
146 W A -0.5269
147 V A -0.3406
148 D A -0.6291
149 S A -0.4399
150 T A -0.3353
151 P A -0.5500
152 P A -0.9562
153 P A -1.5339
154 G A -1.6347
155 T A -1.4393
156 R A -1.9245
157 V A 0.0000
158 R A -1.5692
159 A A 0.0000
160 M A 0.1524
161 A A 0.4192
162 I A 0.7799
163 Y A 0.0000
164 K A -1.3752
165 Q A -2.1610
166 S A -1.5479
167 Q A -1.9194
168 H A -1.6733
169 M A -0.0577
170 T A -0.1829
171 E A -0.6765
172 V A -0.3350
173 V A -0.9386
174 R A -2.4685
175 R A -3.3125
176 C A 0.0000
177 P A -1.9768
178 H A -2.2234
179 H A 0.0000
180 E A -2.9671
181 R A -3.1584
182 C A -1.6422
183 S A -2.0392
184 D A -2.5527
185 S A -1.9762
186 D A -1.9726
187 G A -0.7707
188 L A 0.7560
189 A A 0.0270
190 P A -0.6755
191 P A -1.6574
192 Q A -1.2679
193 H A 0.0000
194 L A 0.0000
195 I A -0.2496
196 R A -0.8363
197 V A 0.0000
198 E A -1.9090
199 G A -1.9422
200 N A -2.3361
201 L A -2.0453
202 R A -2.0798
203 V A -0.6149
204 E A -0.4442
205 Y A 0.3817
206 L A 0.9657
207 D A -0.9658
208 D A -2.3377
209 R A -2.9062
210 N A -2.1265
211 T A -1.2891
212 F A -0.3721
213 R A -0.7762
214 H A 0.0000
215 S A -0.0607
216 V A 0.0000
217 V A -0.2219
218 V A 0.0000
219 P A -1.9218
220 Y A 0.0000
221 E A -3.0122
222 P A -1.7231
223 P A -1.3326
224 E A -0.6291
225 V A 0.8810
226 G A -0.1764
227 S A -0.5019
228 D A -0.8033
229 C A 0.0000
230 T A 0.0000
231 T A 0.0000
232 I A 0.0000
233 H A -0.8310
234 Y A 0.0000
235 N A -0.4891
236 Y A 0.0000
237 M A 0.0000
238 C A 0.0000
239 N A -0.5697
240 S A -1.1435
241 S A -0.9619
242 C A -0.4869
243 M A 0.5695
244 G A -0.7922
245 G A -1.4357
246 M A 0.0000
247 N A -2.2350
248 R A -2.7816
249 R A 0.0000
250 P A -0.9167
251 I A 0.0000
252 L A 0.3649
253 T A 0.0000
254 I A 0.2172
255 I A 0.0000
256 T A 0.0000
257 L A -0.9284
258 E A 0.0000
259 D A -0.9238
260 S A -1.0039
261 S A -0.6793
262 G A -0.9519
263 N A -0.9244
264 L A 0.5991
265 L A 0.0165
266 G A -0.4300
267 R A -1.7734
268 N A 0.0000
269 S A -0.3941
270 F A 0.0000
271 E A -0.1954
272 V A 0.0000
273 R A -0.9132
274 V A 0.0000
275 C A -0.0850
276 A A 0.1702
277 C A -0.8620
278 P A 0.0000
279 G A -1.9554
280 R A -3.0610
281 D A -2.2815
282 R A -2.2582
283 R A -3.1507
284 T A -2.1923
285 E A 0.0000
286 E A -2.8937
287 E A -3.0235
288 N A -3.3125
289 L A 0.0000
290 R A -4.0927
291 K A -4.1677
292 K A -3.7306
293 G A -3.2178
294 E A -2.5752
295 P A -1.6333
296 H A -1.6532
297 H A -1.6377

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -0.7441 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015