Project name: 32b48a7797e0507

Status: done

submitted: 2018-12-17 09:22:58, status changed: 2018-12-17 09:27:13
Settings
Chain sequence(s) A: PTITGNLENQTTSIGESIEVSCTASPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACCAKVEAFFIIEG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.6643
Maximal score value
0.5651
Average score
-1.3202
Total score value
-108.2545

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
667 P A -0.2416
668 T A -0.3187
669 I A -0.3556
670 T A -0.6019
671 G A -1.3874
672 N A -2.4153
673 L A 0.0000
674 E A -3.0995
675 N A -2.3004
676 Q A -1.1058
677 T A -0.6685
678 T A -1.0215
679 S A -1.6025
680 I A -1.6461
681 G A -2.6334
682 E A -3.0564
683 S A -2.7582
684 I A 0.0000
685 E A -2.3385
686 V A 0.0000
687 S A -2.0478
688 C A 0.0000
689 T A -1.1344
690 A A -0.6818
691 S A -0.4439
696 P A -0.6889
697 Q A -1.3593
698 I A 0.0000
699 M A -0.2023
700 W A 0.0000
701 F A -1.2871
702 K A -1.9145
703 D A -2.9067
704 N A -3.2032
705 E A -2.7247
706 T A -1.1263
707 L A -0.5497
708 V A 0.3024
709 E A -1.5470
710 D A -1.8680
711 S A -1.5230
712 G A -2.0735
713 I A 0.0000
714 V A -1.2497
715 L A -1.6460
716 K A -3.1132
717 D A -3.3855
718 G A -2.6185
719 N A -2.5153
720 R A -2.6374
721 N A -2.6237
722 L A 0.0000
723 T A -1.4200
724 I A 0.0000
725 R A -3.6037
726 R A -3.6643
727 V A 0.0000
728 R A -3.6526
729 K A -3.3433
730 E A -3.1536
731 D A -2.1421
732 E A -1.8722
733 G A 0.0000
734 L A -1.0060
735 Y A 0.0000
736 T A 0.0000
737 C A 0.0000
738 Q A -0.6475
739 A A 0.0000
740 C A 0.4324
745 C A 0.5651
746 A A -0.3096
747 K A -1.6182
748 V A -1.6733
749 E A -2.4192
750 A A 0.0000
751 F A -0.4648
752 F A 0.0000
753 I A -0.4649
754 I A 0.0000
755 E A -2.1191
756 G A -1.3573

 

Laboratory of Theory of Biopolymers 2015