Project name: SH3_L124G

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA124G
Energy difference between WT (input) and mutated protein (by FoldX)	2.39 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 0.6361
• Average score: -1.0372
• Total score value: -62.2307

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.5522
82	S	A	-0.7354
83	H	A	-0.8261
84	M	A	0.1960
85	T	A	-0.5435
86	F	A	-0.1941
87	V	A	-0.6632
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2410
99	D	A	-1.3225
100	L	A	0.0000
101	S	A	-1.9033
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.5748
108	L	A	0.0000
109	Q	A	-1.0263
110	I	A	-0.0178
111	V	A	0.6361
112	N	A	-0.7169
113	N	A	-1.9376
114	T	A	-1.7894
115	E	A	-2.9361
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3421
119	W	A	-0.8138
120	L	A	0.1707
121	A	A	0.0000
122	H	A	-1.0552
123	S	A	0.0000
124	G	A	-1.7347	mutated: LA124G
125	T	A	-1.4613
126	T	A	-1.3021
127	G	A	-1.2904
128	Q	A	-1.6827
129	T	A	-0.8025
130	G	A	0.0000
131	Y	A	0.1450
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2908
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0226
139	P	A	-0.1893
140	S	A	-0.1787