Project name: SH3_W118A

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA118A
Energy difference between WT (input) and mutated protein (by FoldX)	2.37312 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4587
• Maximal score value: 1.2548
• Average score: -0.9374
• Total score value: -56.2435

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1038
87	V	A	-0.6194
88	A	A	0.0000
89	L	A	-0.2931
90	Y	A	-0.6978
91	D	A	-2.8036
92	Y	A	-2.0421
93	E	A	-2.8647
94	S	A	0.0000
95	R	A	-2.8056
96	T	A	-2.1988
97	E	A	-2.3939
98	T	A	-1.3084
99	D	A	-1.5081
100	L	A	0.0000
101	S	A	-1.9099
102	F	A	0.0000
103	K	A	-3.4587
104	K	A	-2.8402
105	G	A	-1.9589
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2489
110	I	A	0.4420
111	V	A	1.2548
112	N	A	-0.4646
113	N	A	-1.8859
114	T	A	-1.7854
115	E	A	-3.0404
116	G	A	-2.7207
117	D	A	-2.8773
118	A	A	-1.7467	mutated: WA118A
119	W	A	-0.8989
120	L	A	0.3074
121	A	A	0.0000
122	H	A	-0.3783
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4282
129	T	A	-0.5152
130	G	A	0.0000
131	Y	A	0.0760
132	I	A	0.0000
133	P	A	-0.7273
134	S	A	-1.4223
135	N	A	-1.3112
136	Y	A	-0.2344
137	V	A	0.0000
138	A	A	-0.0204
139	P	A	-0.1505
140	S	A	-0.1759