Project name: SH3_L124E

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA124E
Energy difference between WT (input) and mutated protein (by FoldX)	1.48512 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 0.7384
• Average score: -1.085
• Total score value: -65.1007

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.5166
82	S	A	-0.6877
83	H	A	-0.7916
84	M	A	0.2579
85	T	A	-0.5881
86	F	A	-0.1152
87	V	A	-0.6225
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3229
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.9125
108	L	A	0.0000
109	Q	A	-0.9786
110	I	A	0.1523
111	V	A	0.7384
112	N	A	-0.6718
113	N	A	-1.9379
114	T	A	-1.7896
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.8058
120	L	A	0.2295
121	A	A	0.0000
122	H	A	-1.2193
123	S	A	0.0000
124	E	A	-3.0041	mutated: LA124E
125	T	A	-2.1143
126	T	A	-1.7033
127	G	A	-1.7330
128	Q	A	-1.9105
129	T	A	-0.9060
130	G	A	0.0000
131	Y	A	0.1560
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2910
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0223
139	P	A	-0.1565
140	S	A	-0.1781