Project name: SH3_L120Q

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120Q
Energy difference between WT (input) and mutated protein (by FoldX)	1.81626 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.0693
• Average score: -0.9443
• Total score value: -56.6557

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1650
97	E	A	-2.3637
98	T	A	-1.3454
99	D	A	-1.4619
100	L	A	0.0000
101	S	A	-1.9175
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.3265
110	I	A	0.2806
111	V	A	1.0693
112	N	A	-0.5926
113	N	A	-1.9366
114	T	A	-1.7897
115	E	A	-2.9985
116	G	A	-2.6014
117	D	A	-2.6951
118	W	A	-1.4978
119	W	A	-1.0102
120	Q	A	-0.2250	mutated: LA120Q
121	A	A	0.0000
122	H	A	-0.5224
123	S	A	0.0000
124	L	A	-0.2799
125	T	A	-0.7803
126	T	A	-0.8783
127	G	A	-0.8173
128	Q	A	-1.4128
129	T	A	-0.6372
130	G	A	0.0000
131	Y	A	-0.1422
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3720
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759