Project name: SH3_N113L

Status: done

submitted: 2019-03-14 15:27:07, status changed: 2019-03-14 17:21:19
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues NA113L
Energy difference between WT (input) and mutated protein (by FoldX) -0.564095 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.8784
Average score
-0.7085
Total score value
-42.5101

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4561
82 S A -0.6872
83 H A -0.7912
84 M A 0.2161
85 T A 0.0000
86 F A 0.0000
87 V A -0.7219
88 A A 0.0000
89 L A -0.3370
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2414
99 D A -1.3238
100 L A 0.0000
101 S A -1.9034
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9867
106 E A 0.0000
107 R A -2.1337
108 L A 0.0000
109 Q A -0.3209
110 I A 0.9828
111 V A 1.8784
112 N A 0.9411
113 L A 0.9954 mutated: NA113L
114 T A -0.3531
115 E A -1.9859
116 G A -1.9238
117 D A -2.2766
118 W A -0.7805
119 W A 0.3540
120 L A 1.0637
121 A A 0.0000
122 H A -0.3950
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.4993
130 G A 0.0000
131 Y A 0.5185
132 I A 0.0000
133 P A 0.0000
134 S A -0.9056
135 N A -1.2495
136 Y A -0.2260
137 V A 0.0000
138 A A -0.0883
139 P A -0.2447
140 S A -0.2496

 

Laboratory of Theory of Biopolymers 2015