Project name: SH3_L120V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120V
Energy difference between WT (input) and mutated protein (by FoldX)	2.4404 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.1931
• Average score: -0.9
• Total score value: -53.9975

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4527
82	S	A	-0.6848
83	H	A	-0.7928
84	M	A	0.2639
85	T	A	0.0000
86	F	A	-0.1081
87	V	A	-0.6242
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1057
93	E	A	-2.8817
94	S	A	0.0000
95	R	A	-2.7840
96	T	A	-2.1397
97	E	A	-2.3381
98	T	A	-1.2182
99	D	A	-1.2824
100	L	A	0.0000
101	S	A	-1.8855
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0741
108	L	A	0.0000
109	Q	A	-0.2870
110	I	A	0.3985
111	V	A	1.1931
112	N	A	-0.5164
113	N	A	-1.8609
114	T	A	-1.7689
115	E	A	-2.9642
116	G	A	-2.6203
117	D	A	-2.6770
118	W	A	-1.3490
119	W	A	-0.7263
120	V	A	0.3412	mutated: LA120V
121	A	A	0.0000
122	H	A	-0.4030
123	S	A	0.0000
124	L	A	-0.2793
125	T	A	-0.7784
126	T	A	-0.8768
127	G	A	-0.8151
128	Q	A	-1.4130
129	T	A	-0.4906
130	G	A	0.0000
131	Y	A	0.3012
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2827
135	N	A	-1.2505
136	Y	A	-0.2054
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1520
140	S	A	-0.1759