Project name: SH3_L120D

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120D
Energy difference between WT (input) and mutated protein (by FoldX)	3.66451 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.0592
• Average score: -0.9413
• Total score value: -56.4766

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1602
97	E	A	-2.3589
98	T	A	-1.3270
99	D	A	-1.4345
100	L	A	0.0000
101	S	A	-1.9114
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0701
108	L	A	0.0000
109	Q	A	-0.3264
110	I	A	0.2810
111	V	A	1.0592
112	N	A	-0.6341
113	N	A	-1.9518
114	T	A	-1.8029
115	E	A	-3.0035
116	G	A	-2.6082
117	D	A	-2.6904
118	W	A	-1.4823
119	W	A	-0.9895
120	D	A	-0.1766	mutated: LA120D
121	A	A	0.0000
122	H	A	-0.5113
123	S	A	0.0000
124	L	A	-0.2747
125	T	A	-0.7775
126	T	A	-0.8759
127	G	A	-0.8137
128	Q	A	-1.4111
129	T	A	-0.6170
130	G	A	0.0000
131	Y	A	-0.0832
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3597
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759