Project name: SH3_Y131E

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA131E
Energy difference between WT (input) and mutated protein (by FoldX)	2.14933 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4768
• Maximal score value: 0.876
• Average score: -1.0053
• Total score value: -60.3193

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1047
87	V	A	-0.6192
88	A	A	0.0000
89	L	A	-0.2996
90	Y	A	-0.7088
91	D	A	-2.8397
92	Y	A	-2.0990
93	E	A	-2.8806
94	S	A	0.0000
95	R	A	-2.7819
96	T	A	-2.2843
97	E	A	-2.4845
98	T	A	-1.5411
99	D	A	-1.8157
100	L	A	0.0000
101	S	A	-2.0686
102	F	A	0.0000
103	K	A	-3.4768
104	K	A	-2.8500
105	G	A	-1.9568
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2996
110	I	A	0.1691
111	V	A	0.8760
112	N	A	-1.0872
113	N	A	-2.1833
114	T	A	-1.8777
115	E	A	-3.0131
116	G	A	-2.6586
117	D	A	-2.8068
118	W	A	-1.7153
119	W	A	-1.2194
120	L	A	-0.2330
121	A	A	0.0000
122	H	A	-0.5962
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4108
129	T	A	-0.7183
130	G	A	0.0000
131	E	A	-1.0278	mutated: YA131E
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.4310
135	N	A	-1.2447
136	Y	A	-0.1978
137	V	A	0.0000
138	A	A	-0.0219
139	P	A	-0.1505
140	S	A	-0.1759