Project name: SH3_F86L

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	FA86L
Energy difference between WT (input) and mutated protein (by FoldX)	1.31117 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2721
• Average score: -0.8987
• Total score value: -53.9227

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4473
82	S	A	-0.6793
83	H	A	-0.7912
84	M	A	0.2266
85	T	A	0.0000
86	L	A	0.0000	mutated: FA86L
87	V	A	-0.7215
88	A	A	0.0000
89	L	A	-0.3368
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3192
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9867
106	E	A	0.0000
107	R	A	-2.1264
108	L	A	0.0000
109	Q	A	-0.2861
110	I	A	0.4358
111	V	A	1.2721
112	N	A	-0.4002
113	N	A	-1.7942
114	T	A	-1.7261
115	E	A	-2.9288
116	G	A	-2.6026
117	D	A	-2.6792
118	W	A	-1.3301
119	W	A	-0.6553
120	L	A	0.4304
121	A	A	0.0000
122	H	A	-0.3724
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4918
130	G	A	0.0000
131	Y	A	0.2344
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2760
135	N	A	-1.2463
136	Y	A	-0.2271
137	V	A	0.0000
138	A	A	-0.0876
139	P	A	-0.2367
140	S	A	-0.2494