Project name: SH3_S134V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134V
Energy difference between WT (input) and mutated protein (by FoldX)	-0.291171 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4809
• Maximal score value: 1.2746
• Average score: -0.8747
• Total score value: -52.481

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4456
82	S	A	-0.6777
83	H	A	-0.7912
84	M	A	0.2721
85	T	A	0.0000
86	F	A	-0.1009
87	V	A	-0.6234
88	A	A	0.0000
89	L	A	-0.3075
90	Y	A	-0.7252
91	D	A	-2.8471
92	Y	A	-2.1027
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1549
97	E	A	-2.3535
98	T	A	-1.2430
99	D	A	-1.3294
100	L	A	0.0000
101	S	A	-1.9045
102	F	A	0.0000
103	K	A	-3.4809
104	K	A	-2.8567
105	G	A	-1.9606
106	E	A	0.0000
107	R	A	-2.0685
108	L	A	0.0000
109	Q	A	-0.2262
110	I	A	0.5108
111	V	A	1.2746
112	N	A	-0.3974
113	N	A	-1.7655
114	T	A	-1.7327
115	E	A	-2.9047
116	G	A	-2.5499
117	D	A	-2.5971
118	W	A	-1.2605
119	W	A	-0.6325
120	L	A	0.4440
121	A	A	0.0000
122	H	A	-0.3748
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4914
130	G	A	0.0000
131	Y	A	0.2500
132	I	A	0.0000
133	P	A	0.0000
134	V	A	-0.9873	mutated: SA134V
135	N	A	-1.1023
136	Y	A	-0.1031
137	V	A	0.0000
138	A	A	0.0241
139	P	A	-0.1483
140	S	A	-0.1777