Project name: IKS1

Status: done

submitted: 2018-10-30 01:41:18, status changed: 2018-10-30 01:48:08
Settings
Chain sequence(s) A: GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTTVLLHQDWLNGKEYKCKVSNKALPAPIEKTISIKS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.6861
Maximal score value
1.9053
Average score
-0.8958
Total score value
-94.0583

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
236 G A -0.8046
237 G A -0.8556
238 P A 0.0000
239 S A -0.2999
240 V A 0.0000
241 F A 1.3816
242 L A 1.0947
243 F A 1.4293
244 P A 0.2642
245 P A 0.0000
246 K A -2.4458
247 P A -1.2979
248 K A -1.8294
249 D A -1.4193
250 T A 0.0000
251 L A 1.1460
252 M A 1.3203
253 I A 1.9053
254 S A 0.3313
255 R A -1.3432
256 T A -0.7583
257 P A 0.0000
258 E A -1.0258
259 V A 0.0000
260 T A 0.3834
261 C A 0.0000
262 V A 0.0000
263 V A 0.0000
264 V A -0.6064
265 D A -1.5665
266 V A 0.0000
267 S A -2.0611
268 H A -2.1328
269 E A -2.7042
270 D A -2.2683
271 P A -2.3112
272 E A -2.9487
273 V A -1.8983
274 K A -2.2337
275 F A -1.2750
276 N A -1.4298
277 W A 0.0000
278 Y A -0.9251
279 V A -0.9820
280 D A -2.0867
281 G A -0.9768
282 V A 0.2899
283 E A -1.3116
284 V A -0.6978
285 H A -1.7715
286 N A -1.6725
287 A A -1.6032
288 K A -2.3279
289 T A -2.0300
290 K A -2.7303
291 P A -2.5396
292 R A -3.5488
293 E A -3.6861
294 E A -3.1020
295 Q A -1.7610
296 Y A 0.1366
297 N A -0.7867
298 S A -1.2156
299 T A -1.8836
300 Y A -2.4932
301 R A -2.6412
302 V A 0.0000
303 V A 0.0000
304 S A 0.0000
305 V A -0.7526
306 L A 0.0000
307 T A -0.4608
308 V A 0.0000
309 L A 1.0501
310 H A 0.5713
311 Q A -0.4493
312 D A -0.8771
313 W A 0.0000
314 L A 0.2012
315 N A -1.4165
316 G A -1.3895
317 K A -1.9285
318 E A -2.0581
319 Y A 0.0000
320 K A -1.6811
321 C A 0.0000
322 K A -1.7699
323 V A 0.0000
324 S A -1.5128
325 N A 0.0000
326 K A -2.4673
327 A A -1.3355
328 L A -0.6125
329 P A -0.4389
330 A A -0.4495
331 P A -0.9876
332 I A -0.7359
333 E A -2.1482
334 K A -1.1983
335 T A -0.9539
336 I A 0.0016
337 S A 0.0000
338 I A 0.3083
339 K A -1.3060
340 S A -0.6546

 

Laboratory of Theory of Biopolymers 2015