Project name: SH3_S94K

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA94K
Energy difference between WT (input) and mutated protein (by FoldX)	1.74962 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4759
• Maximal score value: 1.2501
• Average score: -0.956
• Total score value: -57.363

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1040
87	V	A	-0.6218
88	A	A	0.0000
89	L	A	-0.3110
90	Y	A	-0.7348
91	D	A	-2.8445
92	Y	A	-2.2141
93	E	A	-3.1215
94	K	A	-2.6774	mutated: SA94K
95	R	A	-3.0315
96	T	A	-2.2990
97	E	A	-2.4267
98	T	A	-1.2799
99	D	A	-1.3993
100	L	A	0.0000
101	S	A	-2.0410
102	F	A	0.0000
103	K	A	-3.4759
104	K	A	-2.8605
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4375
111	V	A	1.2501
112	N	A	-0.4191
113	N	A	-1.8131
114	T	A	-1.7322
115	E	A	-2.9351
116	G	A	-2.6073
117	D	A	-2.6821
118	W	A	-1.3271
119	W	A	-0.6853
120	L	A	0.4201
121	A	A	0.0000
122	H	A	-0.3837
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8743
127	G	A	-0.8169
128	Q	A	-1.3977
129	T	A	-0.4745
130	G	A	0.0000
131	Y	A	0.1969
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2829
135	N	A	-1.2463
136	Y	A	-0.1996
137	V	A	0.0000
138	A	A	-0.0206
139	P	A	-0.1505
140	S	A	-0.1759