Project name: SH3_Y136T

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA136T
Energy difference between WT (input) and mutated protein (by FoldX)	1.62609 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4112
• Maximal score value: 1.2498
• Average score: -0.9007
• Total score value: -54.0398

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1384
87	V	A	-0.6425
88	A	A	0.0000
89	L	A	-0.3029
90	Y	A	-0.5916
91	D	A	-2.7612
92	Y	A	-2.0312
93	E	A	-2.8446
94	S	A	0.0000
95	R	A	-2.7749
96	T	A	-2.1519
97	E	A	-2.3506
98	T	A	-1.2380
99	D	A	-1.3119
100	L	A	0.0000
101	S	A	-1.8783
102	F	A	0.0000
103	K	A	-3.4112
104	K	A	-2.8032
105	G	A	-1.9233
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4205
113	N	A	-1.8151
114	T	A	-1.7334
115	E	A	-2.9374
116	G	A	-2.6134
117	D	A	-2.6944
118	W	A	-1.3892
119	W	A	-0.7061
120	L	A	0.4011
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4112
129	T	A	-0.4937
130	G	A	0.0000
131	Y	A	0.2152
132	I	A	0.0000
133	P	A	-0.6549
134	S	A	-1.4030
135	N	A	-1.3855
136	T	A	0.0000	mutated: YA136T
137	V	A	0.0000
138	A	A	-0.0859
139	P	A	-0.1505
140	S	A	-0.1759