Project name: Dr Anthony Keeble

Status: done

submitted: 2018-12-04 11:51:51, status changed: 2018-12-04 11:57:37
Settings
Chain sequence(s) A: GAMVDTLDSATHIKFSKRDIDGKELAGATMELRDSSGKTISTWISDGQVKDFYLMPGKYTFVETAAPDGYEVATTAITFTVNEQGQVTVNGKATKGDAHIVMVDA
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.9902
Maximal score value
1.2874
Average score
-0.8505
Total score value
-88.452

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
-2 G A 0.0057
-1 A A -0.0296
0 M A -0.2636
1 V A 0.0000
2 D A -2.1197
3 T A -1.2768
4 L A 0.3801
22 D A -2.2284
23 S A -1.4669
24 A A -0.4361
25 T A -0.9012
26 H A -0.5811
27 I A 0.0000
28 K A -0.9812
29 F A 0.0000
30 S A 0.0000
31 K A 0.0000
32 R A -1.5548
33 D A -0.7675
34 I A 0.4759
35 D A -1.7128
36 G A -1.6885
37 K A -2.9328
38 E A -2.9902
39 L A -1.6457
40 A A -1.2686
41 G A -0.3886
42 A A 0.0000
43 T A 0.5782
44 M A 0.0000
45 E A -0.0530
46 L A 0.0000
47 R A -1.4173
48 D A -1.6568
49 S A -1.6991
50 S A -1.4949
51 G A -1.7771
52 K A -2.0523
53 T A -0.8175
54 I A 0.3522
55 S A 0.0872
56 T A 0.4506
57 W A 0.6164
58 I A 1.2874
59 S A -0.5155
60 D A -1.9623
61 G A -2.2094
62 Q A -2.3088
63 V A -1.1215
64 K A -1.2380
65 D A -1.5140
66 F A 0.0000
67 Y A 0.9292
68 L A 0.0000
69 M A -0.2953
70 P A -1.4262
71 G A -1.3001
72 K A -2.1087
73 Y A 0.0000
74 T A -0.9488
75 F A 0.0000
76 V A 0.1350
77 E A 0.0000
78 T A 0.1631
79 A A -0.0143
80 A A -0.4352
81 P A -1.1327
82 D A -2.2215
83 G A -1.4720
84 Y A -1.1027
85 E A -1.5954
86 V A 0.0079
87 A A -0.0341
88 T A -0.0976
89 A A 0.1001
90 I A 0.0000
91 T A -0.7536
92 F A 0.0000
93 T A -1.1022
94 V A 0.0000
95 N A -2.1953
96 E A -2.6302
97 Q A -2.6879
98 G A -2.2371
99 Q A -2.1474
100 V A 0.0000
101 T A -1.6052
102 V A 0.0000
103 N A -1.8473
104 G A -1.7976
105 K A -2.2090
106 A A -1.7020
107 T A -2.0593
108 K A -2.9749
109 G A -2.4183
110 D A -2.3631
111 A A 0.0000
112 H A 0.0000
113 I A 0.0000
114 V A 0.0000
115 M A 0.0000
116 V A -0.0684
117 D A 0.0000
118 A A 0.0340

 

Laboratory of Theory of Biopolymers 2015