Project name: SH3_L120P

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120P
Energy difference between WT (input) and mutated protein (by FoldX)	3.73821 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.1672
• Average score: -0.9059
• Total score value: -54.3537

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4441
82	S	A	-0.6764
83	H	A	-0.7912
84	M	A	0.2751
85	T	A	0.0000
86	F	A	-0.0932
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1057
93	E	A	-2.8817
94	S	A	0.0000
95	R	A	-2.7840
96	T	A	-2.1296
97	E	A	-2.3279
98	T	A	-1.2235
99	D	A	-1.2807
100	L	A	0.0000
101	S	A	-1.8728
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0657
108	L	A	0.0000
109	Q	A	-0.2738
110	I	A	0.4156
111	V	A	1.1672
112	N	A	-0.5585
113	N	A	-1.8891
114	T	A	-1.7956
115	E	A	-2.9930
116	G	A	-2.6220
117	D	A	-2.6723
118	W	A	-1.3834
119	W	A	-0.7991
120	P	A	0.1718	mutated: LA120P
121	A	A	0.0000
122	H	A	-0.4135
123	S	A	0.0000
124	L	A	-0.2799
125	T	A	-0.7803
126	T	A	-0.8783
127	G	A	-0.8173
128	Q	A	-1.4129
129	T	A	-0.5079
130	G	A	0.0000
131	Y	A	0.2979
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2960
135	N	A	-1.2521
136	Y	A	-0.2062
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1447
140	S	A	-0.1759