Project name: SH3_W118D

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA118D
Energy difference between WT (input) and mutated protein (by FoldX)	2.67177 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.5835
• Maximal score value: 1.2548
• Average score: -1.048
• Total score value: -62.8775

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1038
87	V	A	-0.6194
88	A	A	0.0000
89	L	A	-0.2931
90	Y	A	-0.6978
91	D	A	-2.8036
92	Y	A	-2.0413
93	E	A	-2.8651
94	S	A	0.0000
95	R	A	-2.8061
96	T	A	-2.1996
97	E	A	-2.3946
98	T	A	-1.3096
99	D	A	-1.6840
100	L	A	0.0000
101	S	A	-1.9105
102	F	A	0.0000
103	K	A	-3.4587
104	K	A	-2.8402
105	G	A	-1.9589
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2489
110	I	A	0.4420
111	V	A	1.2548
112	N	A	-0.6582
113	N	A	-2.1783
114	T	A	-1.9884
115	E	A	-3.4407
116	G	A	-3.1281
117	D	A	-3.5835
118	D	A	-3.2014	mutated: WA118D
119	W	A	-1.6106
120	L	A	-0.0181
121	A	A	0.0000
122	H	A	-0.3783
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4285
129	T	A	-0.5157
130	G	A	0.0000
131	Y	A	-0.3265
132	I	A	0.0000
133	P	A	-1.2760
134	S	A	-1.8825
135	N	A	-1.5113
136	Y	A	-0.3821
137	V	A	0.0000
138	A	A	-0.0203
139	P	A	-0.1505
140	S	A	-0.1759