Project name: SH3_S94Q

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA94Q
Energy difference between WT (input) and mutated protein (by FoldX)	2.80891 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4867
• Maximal score value: 1.2504
• Average score: -0.944
• Total score value: -56.6419

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1036
87	V	A	-0.6220
88	A	A	0.0000
89	L	A	-0.3146
90	Y	A	-0.7437
91	D	A	-2.8592
92	Y	A	-2.1793
93	E	A	-3.0161
94	Q	A	-2.4368	mutated: SA94Q
95	R	A	-2.9137
96	T	A	-2.2269
97	E	A	-2.3873
98	T	A	-1.2551
99	D	A	-1.3539
100	L	A	0.0000
101	S	A	-1.9862
102	F	A	0.0000
103	K	A	-3.4867
104	K	A	-2.8651
105	G	A	-1.9631
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4378
111	V	A	1.2504
112	N	A	-0.4176
113	N	A	-1.8111
114	T	A	-1.7310
115	E	A	-2.9328
116	G	A	-2.6049
117	D	A	-2.6777
118	W	A	-1.3213
119	W	A	-0.6838
120	L	A	0.4184
121	A	A	0.0000
122	H	A	-0.3833
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8771
127	G	A	-0.8169
128	Q	A	-1.4051
129	T	A	-0.4830
130	G	A	0.0000
131	Y	A	0.2176
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2788
135	N	A	-1.2442
136	Y	A	-0.1995
137	V	A	0.0000
138	A	A	-0.0199
139	P	A	-0.1505
140	S	A	-0.1759