Project name: SH3_Y90E

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA90E
Energy difference between WT (input) and mutated protein (by FoldX)	0.744719 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -4.2571
• Maximal score value: 1.2498
• Average score: -1.0604
• Total score value: -63.6263

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.0754
87	V	A	-0.9176
88	A	A	0.0000
89	L	A	-1.5840
90	E	A	-3.5892	mutated: YA90E
91	D	A	-4.2571
92	Y	A	-2.8159
93	E	A	-2.8834
94	S	A	0.0000
95	R	A	-2.7841
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3233
100	L	A	0.0000
101	S	A	-1.9046
102	F	A	0.0000
103	K	A	-4.1982
104	K	A	-4.0377
105	G	A	-2.4487
106	E	A	0.0000
107	R	A	-2.0624
108	L	A	0.0000
109	Q	A	-0.2458
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3439
119	W	A	-0.6978
120	L	A	0.4047
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2197
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2901
135	N	A	-1.5632
136	Y	A	-0.9724
137	V	A	0.0000
138	A	A	0.0161
139	P	A	-0.1430
140	S	A	-0.1681